DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and cgr-1

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:421 Identity:90/421 - (21%)
Similarity:168/421 - (39%) Gaps:85/421 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LGQLSPMQESKLLELRKMLDGVDDLERVPSYQT---ILRFLAARDWHVSQAYAMLCDSLRW---- 271
            |.:|:..|:.|:.|||....  |.|...|.|.|   :||:|...|:.:.    ::...:|:    
 Worm    10 LNELTAHQKDKIAELRSKTK--DILATYPEYDTDFSLLRWLMGWDYKID----VIVPKMRYAVET 68

  Fly   272 --------RREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMD 328
                    ::...:|.:..:....:.|.|:||||.....|.|..||:..:.....|.|:|:....
 Worm    69 LVNLGMNNKQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHPKTLVKAGPTS 133

  Fly   329 GLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYP 393
            .|.:|.:...|...:.|.::.:..|:. :...:::||:|.||..|:.|.:|..::::..::..:|
 Worm   134 QLFQLCISETEMSFKIIRQTEQETERK-MGVIIIMDLDGFSMDLLYTPTLKVYMSLLTMLQNIFP 197

  Fly   394 ETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG-- 456
            :...|:.::..|.:....:.:||..:...||.|..|...|   .|:.|.:.:.||.:....||  
 Worm   198 DFARRIYIINCPAMMSAVYAMVSPVLSSQTREKVRFLDKD---WKNHLIEEIGEENIFMHWGGVK 259

  Fly   457 ----PCKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYK 517
                ||.. |..||.||::|:..:|.:...|.....:|..:..:..:.|:  |....|       
 Worm   260 KHEHPCGD-IRMGGKVPESLWYADSHKLEGDRTKIAVPARSKTEIKMYGE--SGKYFH------- 314

  Fly   518 SVDLKAGFAHELLIRNEDPKSVLTWDFDVMRNDLHFTLYRVTQELPEKNDSAV--SYFDLQDFVE 580
                                    |.:.|...|:.|::        ||:...|  .:..|.:|..
 Worm   315 ------------------------WLWRVSSGDIDFSI--------EKDGRVVWPVFRCLTEFHP 347

  Fly   581 GVNYFREEPTLICRHKESVQGSHVMHHNDSY 611
            .:..|:.|.|          |.:|...|:|:
 Worm   348 EIGSFKIEET----------GEYVFIFNNSH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 13/48 (27%)
CRAL_TRIO 293..456 CDD:279044 38/162 (23%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 40/169 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.