DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and F18A11.2

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:411 Identity:80/411 - (19%)
Similarity:161/411 - (39%) Gaps:78/411 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 SPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLA 282
            :|::::.:|.:...:|..|| :.......:.|:|.|......:|...|...|..|:  .||  |.
 Worm     4 NPVEKAAILRIIDSIDARDD-DYCAHEFNVYRWLVAYGNEEEEAAKALKRHLNIRK--TID--LN 63

  Fly   283 EYSKPAVVVE-----HFP---GGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICE 339
            .||....:.|     :.|   .|.:|.| |.:.:...|.|.:|:.||:.::.|...:::.|.:.|
 Worm    64 SYSSKTELEEDELNKYVPIDVIGQNHQD-DNKVLMFERTGKIDISGLVDNVLMHKFMQIKLKMME 127

  Fly   340 EGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLN-----IIETVERNYPETMGRV 399
            ...||: .:|||..........::||:|:|    :.|.:.::|.     :..|:..:||:.:.::
 Worm   128 GVHQKV-VAAERKTGRQSGGLFIMDLDGIS----FSPKLISVLTGPYRIMWGTLFDHYPQLLQKI 187

  Fly   400 LVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHE 464
            ::|.||....:.....|.|:.|..:.|.:.......   ..:.::.|:..:|..|||.    :.:
 Worm   188 IIVNAPSFVNVLHQACSPFLPEDYKEKIVITSEPAI---GAIQKHADKCFLPSDLGGD----LEK 245

  Fly   465 GGLVPKTLY-KMNSLEDHDDEVTAELPTTAAAQALVPGKRLSA----------------NQQHDH 512
            ...:|...: |||...:.:.|..:.|..:      ||..:.:.                |:...|
 Worm   246 TTSLPMAPFPKMNKKYEKEKEKVSLLAIS------VPAGKYTVQKFSWKKGDEVEFFLHNESSFH 304

  Fly   513 RNLY------KSVDLKAGFAHELLIRNEDP--KSVLTWDFDVMRNDLHFTLY------------R 557
            ..::      |.:||    ..|:.:..|.|  ..:.:|.:.|..:..:|..|            .
 Worm   305 YFMFHSEEDTKDMDL----WREMTVGCERPALSQIDSWKYTVPIDGFYFIRYGNHNSWYFSTTVN 365

  Fly   558 VTQELPEKNDSAVSYFDLQDF 578
            |...:..:|...:....::.|
 Worm   366 VNHFISNENGERIELVPIETF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 9/45 (20%)
CRAL_TRIO 293..456 CDD:279044 37/170 (22%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 40/184 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.