DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and H41C03.1

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:284 Identity:64/284 - (22%)
Similarity:118/284 - (41%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 YQT---ILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAVVVEHFPGGW-HHLDKD 304
            |.|   :||:.....:...:|.|.|...||:|:.:.:|.:|.......::.::||.|. ....||
 Worm    24 YDTDFNLLRWAQGYGFDKDEALAELRRHLRFRQYYDLDNILTNVPDHPILKKYFPLGLVGETGKD 88

  Fly   305 GRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLS 369
            .:.:.|...|.:|:.|:|||:.:...|.......|:.:..:|| .||......:...::|||||.
 Worm    89 NQLLVIECAGRIDLMGILKSVHLSDFLIQRFKFQEKMLAAMNE-MERKYGTQCSVIYILDLEGLK 152

  Fly   370 MRHLWRPGIKALLNII--------ETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSK 426
            ..       .||::|:        .:|...|||.:..:.::.||....:.|..:...:.|.||:|
 Worm   153 FD-------PALISIVTGPYRILWASVYTAYPEWINTLFLINAPSFMTLLWKAIGPLLPERTRNK 210

  Fly   427 FLFYGPDCAHMKDGLAQYLDEEIVPDFLGGPCKTMIHEGG-------------LVPKTLYKMNSL 478
            ......: :..|..:.::...:.:|...||   |::.:.|             .:|:.||...: 
 Worm   211 VRICSGN-SDWKTSVQKHAHIDNIPKHWGG---TLVDKNGDGMCRDILNIPFDSIPQELYWTPT- 270

  Fly   479 EDHDDEVTAELPTTAAAQALVPGK 502
              |:.....:|..|    .:.|||
 Worm   271 --HETPAIKDLVCT----NIGPGK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 7/26 (27%)
CRAL_TRIO 293..456 CDD:279044 39/171 (23%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 42/184 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.