DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and LOC110439320

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:XP_021330480.1 Gene:LOC110439320 / 110439320 -ID:- Length:230 Species:Danio rerio


Alignment Length:235 Identity:76/235 - (32%)
Similarity:108/235 - (45%) Gaps:64/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 IHEGGLVPKTLYK-MNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGF 525
            |.|||||||:||: ...||:.:.::..|                         .:|||..:..|.
Zfish    10 IPEGGLVPKSLYRTAEELENEEVKLWNE-------------------------TIYKSASVLKGA 49

  Fly   526 AHELLIRNEDPKSVLTWDFDVMRNDLHFTLY---RVTQELPEKNDSA----------VSYFDLQD 577
            .||:||...|..||:||||||.:.|:.|.:|   |..|.:.::..||          |.:.| :.
Zfish    50 PHEVLIEITDVSSVITWDFDVCKGDMIFNIYHSRRAPQPVKKEGLSAHNLACPAGNNVQFID-RS 113

  Fly   578 FVEGVNYFREEPTLICRHKESVQGSHVMHHNDSYLMHW---FSPSG------------AQLNV-- 625
            ::.|.:|...|..|.||..||||||||......|::.|   .:||.            |.|.|  
Zfish   114 WMLGQDYSMVETALTCREGESVQGSHVTRWPGFYILQWRLYSTPSCSSSSRPRVDDVLASLQVSS 178

  Fly   626 -------FYEVLSSANYKGSMTSLQSAFSSNSSAASSVQS 658
                   |.|||.||:::|||:||:|:.|..|..::|..|
Zfish   179 HRCKVMYFTEVLQSADFRGSMSSLESSHSGFSLLSASTTS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024
CRAL_TRIO 293..456 CDD:279044
LOC110439320XP_021330480.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.