DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment retm and sec14l3

DIOPT Version :9

Sequence 1:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001120265.1 Gene:sec14l3 / 100145318 XenbaseID:XB-GENE-951877 Length:410 Species:Xenopus tropicalis


Alignment Length:413 Identity:108/413 - (26%)
Similarity:199/413 - (48%) Gaps:60/413 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LGQLSPMQESKLLELRKMLDGVDDL-ERVPSYQT----ILRFLAARDWHVSQAYAMLCDSLRWRR 273
            :|.|||.||..|::.|   :.|.|| .|:|.:..    :||:|.||.:::.:|..||..::.:|:
 Frog     5 VGDLSPKQEEALVKFR---ENVKDLMPRLPPFSQDDYFLLRWLRARSFNLQKAENMLRKNVEFRK 66

  Fly   274 EHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHIC 338
            :...|.:|.::..|.||.::..||....|::..|::...:|.:|.||||.|.....|::..:..|
 Frog    67 QMDSDNVLEKWQPPEVVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASKQDLMKTKMRDC 131

  Fly   339 EEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVR 403
            |.........:|:|.|.|.:..::.|:|||.::|||:|.::....|::..|.||||.:.|:.|::
 Frog   132 EVLHHACRMQSEKLGKRVEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNYPEALKRLFVIK 196

  Fly   404 APRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG---------PCK 459
            ||::||:|:.::..|:.|.||.|.:..|.   :.:|.|.:|:..|.:|.:.||         .||
 Frog   197 APKLFPVAYNLIKHFLSEDTRRKIMVLGD---NWQDVLKKYIAPEELPQYYGGTLTDPDGDPKCK 258

  Fly   460 TMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAG 524
            :.|:.||.:||..|..:.::                                 :|...::::..|
 Frog   259 SKINYGGDIPKKYYVRDQVK---------------------------------QNYENTLNINRG 290

  Fly   525 FAHELLIRNEDPKSVLTWDFDVMRNDLHFTLYRVTQE-LPEKNDSAVSYFDLQDFVEGVNYFREE 588
            .:.::......|..||.|.|.....|:.|.:||.|:. ..:|....|.....|.:  ..:...|:
 Frog   291 SSQQMEYEILFPSCVLRWQFQSDGADIGFGIYRKTKAGERQKAGEMVEVLANQRY--NAHMVPED 353

  Fly   589 PTLICRHKESVQGSHVMHHNDSY 611
            .|:.|    :..|::|:..:::|
 Frog   354 GTMTC----TEPGTYVLRFDNTY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 16/50 (32%)
CRAL_TRIO 293..456 CDD:279044 50/162 (31%)
sec14l3NP_001120265.1 CRAL_TRIO_N 13..60 CDD:215024 16/49 (33%)
SEC14 79..248 CDD:214706 55/171 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0000197
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1304
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.