DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9527 and CG4860

DIOPT Version :9

Sequence 1:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster


Alignment Length:424 Identity:89/424 - (20%)
Similarity:165/424 - (38%) Gaps:97/424 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QHPDYQREPGSDLERTREMANKRQHLLWEQQFYGVNEYLGTPHLLLAFG-QAIFSYDFSTSVKFG 153
            :|.|  ||.....|:.|.:.......:..::.||.:   |..:...|.| :.:...|.:.|:..|
  Fly    61 RHHD--REELYPAEQVRRLGELGLMSVTVREEYGGS---GLDYQAYAIGMEEVARGDAAVSIVMG 120

  Fly   154 LSTGMFPSTLVSNGSGRLGK-YVAKIADNRILGAYALTEISHGTNALGMRTRA-----TYDVKRQ 212
            :: .::...:..:|:.:..: ::........:..|||:|..:|::|....|.|     :|.:   
  Fly   121 VN-NLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQI--- 181

  Fly   213 EFIIHTPDFEAAKCWVGNLGKTCTHAIVYAQLYVPDD--KHQGLQAFLVPIRDERTLLPFPGVTV 275
                     ...|.|:.| .|..:..||:|.:   |.  ||:|:.|||.| :|      .||:::
  Fly   182 ---------NGTKAWISN-SKEASGGIVFATV---DKSMKHKGITAFLTP-KD------VPGLSI 226

  Fly   276 GDMGEKIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSKIKDERKRLGASLGALSVGRV 340
            .....|:|:.......::.....:|::.:|...||       ..||         ::.:|..||:
  Fly   227 AKKESKMGMRATSTCQLVLEDVHVPRSRVLGAAGD-------GFKI---------AMQSLDCGRI 275

  Fly   341 NITAITYVALSKAVTIATRYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLATTIAL-RVAT-- 402
            .|.|........|:.:|..|:..|..||  ...|...:|:.:      :..:||.:.: |:.|  
  Fly   276 GIAAQATGIAQAALELAVDYSQKRVAFG--KHLARLQLIQQK------LADMATRVEISRLLTWR 332

  Fly   403 -LWIGKENVDLTMKGFTGEDTSQAGM-EIHAISSALKPVATWAARDGIQECREACGGHGYLKSSG 465
             .|:....:.:         |.:|.| ::||..|     ||:.|    .:|.:..||.||     
  Fly   333 AAWLKDNGLPI---------TKEAAMAKLHASES-----ATFCA----HQCIQILGGMGY----- 374

  Fly   466 LGELRNDNDANCTYEGENNTLIQQASNWLISLQR 499
                ..|..|...|.....|.|.:.::   .:||
  Fly   375 ----TTDLPAELYYRNARVTEIYEGTS---EIQR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 89/424 (21%)
PLN02312 56..682 CDD:215178 89/424 (21%)
CG4860NP_650163.2 CaiA 37..414 CDD:224871 89/424 (21%)
SCAD_SBCAD 39..410 CDD:173847 89/424 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.