DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9527 and acadm

DIOPT Version :9

Sequence 1:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_998175.2 Gene:acadm / 406283 ZFINID:ZDB-GENE-040426-1945 Length:426 Species:Danio rerio


Alignment Length:365 Identity:87/365 - (23%)
Similarity:136/365 - (37%) Gaps:92/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LAFGQAIFSYDFSTSVKFGL---STGMFPSTLVSNGSGRLGKYVAKIADNRILGAYALTEISHGT 196
            ||:|        .|.|:..:   |.|..|..:..|.:.| .||:.::.:..::.||.:||...|:
Zfish   117 LAYG--------CTGVQTAIEANSLGQMPVIIAGNDAQR-KKYLGRMTEEPLMCAYCVTEPGAGS 172

  Fly   197 NALGMRTRATYDVKRQEFIIHTPDFEAAKCWVGNLGKTCTHAIVYAQLYV------PDDKHQGLQ 255
            :..|::|||.  .|..:::|:     ..|.|:.|.||        |..|.      .|.|....:
Zfish   173 DVAGIKTRAV--KKGDDYVIN-----GQKMWITNGGK--------ANWYFLLARTDSDPKCPASK 222

  Fly   256 AFLVPIRDERTLLPFPGVTVGDMGEKIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSK 320
            ||...|.|..|    |||..|.....:|....|...:.|....|||.|:|...|           
Zfish   223 AFTGFIVDADT----PGVQPGRKELNMGQRCSDTRGITFEDVVIPKENVLIGEG----------- 272

  Fly   321 IKDERKRLGASLGALSVGRVNITAITYVALSKAVTIATRYAASRRQFGPTNSPAEWPVIEYQSQQ 385
                 .....::||....|..:.|.......:|:..||:||..|:.||..       :.|:|:..
Zfish   273 -----AGFKIAMGAFDKTRPPVAAGATGLAQRALEEATKYAMERKTFGKF-------IAEHQAVS 325

  Fly   386 YRLIPHLATTIAL-RVA---TLW---IGKENVDLT--MKGFTGEDTSQAGMEIHAISSALKPVAT 441
            : |:..:|..:.| |:|   ..|   :|:.|....  .|.|.|:                  :|.
Zfish   326 F-LLAEMAMKVELARMAYQRAAWEVDMGRRNTYYASIAKAFAGD------------------IAN 371

  Fly   442 WAARDGIQECREACGGHGYLKSSGLGELRNDNDANCTYEG 481
            ..|.|.:|    ..||:|:.....:.:|..|......|||
Zfish   372 QCASDAVQ----IFGGNGFNSEYPVEKLMRDAKIYQIYEG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 87/365 (24%)
PLN02312 56..682 CDD:215178 87/365 (24%)
acadmNP_998175.2 CaiA 44..426 CDD:224871 87/365 (24%)
MCAD 46..423 CDD:173846 87/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.