DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9527 and CG3902

DIOPT Version :9

Sequence 1:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_649069.2 Gene:CG3902 / 40059 FlyBaseID:FBgn0036824 Length:414 Species:Drosophila melanogaster


Alignment Length:341 Identity:81/341 - (23%)
Similarity:138/341 - (40%) Gaps:73/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 STSVKFGLSTGMFPSTLVSNGSGRLGKYVAKIADNRILGAYALTEISHGTNALGMRTRATYDVKR 211
            |..:|||             .:.:..||:.|:| ....|::||||...|::|..::|.|..|  .
  Fly   128 SLMIKFG-------------NAEQKAKYLPKLA-QEYAGSFALTEPGAGSDAFSLKTVAKKD--G 176

  Fly   212 QEFIIHTPDFEAAKCWVGNLGKTCTHAIVYAQLYVPDDKHQGLQAFLVPIRDERTLLPFPGVTVG 276
            ..::|:     .:|.|:.| .......:::|.. .|:|.::|:..|:|   |..|    ||:.|.
  Fly   177 SHYVIN-----GSKMWISN-SDVAGVFLIFANA-KPEDGYRGITTFIV---DRET----PGLIVN 227

  Fly   277 DMGEKIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQG-NYTSKIKDERKRLGASLGALSVGRV 340
            ...:|:|:.......:.|:..|:|:.|:|...|    .| .|.:             |.|:.||:
  Fly   228 KPEDKLGIRASGTCQLTFDNVRVPEENILGTFG----HGYKYAA-------------GFLNEGRI 275

  Fly   341 NITAITYVALSKAVTIAT-RYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLATTI-ALRVATL 403
            .|.| ..|.|::....|| .|...|:|||..       :..:||.|:: |..:||.| |.|:.| 
  Fly   276 GIAA-QMVGLAQGTFDATIPYLLERKQFGDA-------IYNFQSMQHQ-IATVATEIEAARLMT- 330

  Fly   404 WIGKENVDLTMKGFTGEDTSQAGMEIHAISSALKPVATWAARDGIQECREACGGHGYLKSSGLGE 468
                         :......:.|:.....::..|..|:..|:....:|.:..||.|:.:.....:
  Fly   331 -------------YNAARLQEQGVPFQKEAAMAKYYASEVAQRAAIKCVDWMGGVGFTRDFPQEK 382

  Fly   469 LRNDNDANCTYEGENN 484
            ...|......|||..|
  Fly   383 YYRDVKIGAIYEGTTN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 81/341 (24%)
PLN02312 56..682 CDD:215178 81/341 (24%)
CG3902NP_649069.2 CaiA 37..414 CDD:224871 81/341 (24%)
SCAD_SBCAD 39..410 CDD:173847 81/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460764
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.