DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9527 and ACAD9

DIOPT Version :9

Sequence 1:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_054768.2 Gene:ACAD9 / 28976 HGNCID:21497 Length:621 Species:Homo sapiens


Alignment Length:597 Identity:132/597 - (22%)
Similarity:235/597 - (39%) Gaps:135/597 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PGSDLERTREMANKRQHLLWEQQFYGV---NEY--LGTPHLLLAFGQAIFSYDFSTSVKFGLSTG 157
            |...||:.:.:.           .:|:   .||  ||..:.:.:....|.|.|.|.:|.......
Human    94 PDETLEKLKSLG-----------LFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLAAHQA 147

  Fly   158 M-FPSTLVSNGSGRLGKYVAKIADNRILGAYALTEISHGTNALGMRTRATYDVKRQEFIIHTPDF 221
            : ....:::....:..||:.|:|....:.|:.|||.:.|::|..:|:|||....::.:|::    
Human   148 IGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRATLSEDKKHYILN---- 208

  Fly   222 EAAKCWVGNLGKTCTHAIVYAQLYVPD------DKHQGLQAFLVPIRDERTLLPFPGVTVGDMGE 280
             .:|.|:.| |.......|:|:..|.|      ||   :.||:|. ||      |.|||.|...:
Human   209 -GSKVWITN-GGLANIFTVFAKTEVVDSDGSVKDK---ITAFIVE-RD------FGGVTNGKPED 261

  Fly   281 KIGLNGIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSKIKDERKRLGASLGALSVGRVNITAI 345
            |:|:.|.:...|.|...:||..|:|.:.||                ....::..|:.||.::.::
Human   262 KLGIRGSNTCEVHFENTKIPVENILGEVGD----------------GFKVAMNILNSGRFSMGSV 310

  Fly   346 TYVALSKAVTIATRYAASRRQFGPTNSPAEWPVIEYQSQQYRLIPHLATTIALRVATLWIGKENV 410
            ....|.:.:.:...||.:|:||....|  |:.:|:   :::.|:..               |..|
Human   311 VAGLLKRLIEMTAEYACTRKQFNKRLS--EFGLIQ---EKFALMAQ---------------KAYV 355

  Fly   411 DLTMKGFTGEDTSQAGMEIHAISSAL-KPVATWAARDGIQECREACGGHGYLKSSGLGELRNDND 474
            ..:|...|.....|.|....:|.:|: |..::.||...:.|..:..||.||.:......:..|..
Human   356 MESMTYLTAGMLDQPGFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTRDYPYERILRDTR 420

  Fly   475 ANCTYEGENNTLIQQASNWLISLQRNNADFVAVSPLETVSFLKDMDTILQSKGQERTPAEVLDPL 539
            ....:||.|..|..               ::|::.|:...      .||.::..|...|:|    
Human   421 ILLIFEGTNEILRM---------------YIALTGLQHAG------RILTTRIHELKQAKV---- 460

  Fly   540 NLLNALNWLTVWQLDTTVKRVEEQQREGKDAFETRNNIQVF-----AAQKL---SIIYGERTIYY 596
                    .||  :||..:|:.:......|...|.|:..|.     :|.|.   :..:| ||:..
Human   461 --------STV--MDTVGRRLRDSLGRTVDLGLTGNHGVVHPSLADSANKFEENTYCFG-RTVET 514

  Fly   597 VFYKFVIGLPDSAEKKVLQQV----LSFYGAHLVTKYSAAFYRGGYFRENSNQ--------LELY 649
            :..:|  |.....|:.||::|    ::.||...|...::...|.| .|.:.::        :|.|
Human   515 LLLRF--GKTIMEEQLVLKRVANILINLYGMTAVLSRASRSIRIG-LRNHDHEVLLANTFCVEAY 576

  Fly   650 EQGILALLPLLK 661
            .|.:.:|..|.|
Human   577 LQNLFSLSQLDK 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 132/597 (22%)
PLN02312 56..682 CDD:215178 132/597 (22%)
ACAD9NP_054768.2 VLCAD 38..445 CDD:173850 95/428 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.