DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9527 and acdh-4

DIOPT Version :9

Sequence 1:NP_001137800.1 Gene:CG9527 / 33898 FlyBaseID:FBgn0031813 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001300435.1 Gene:acdh-4 / 172367 WormBaseID:WBGene00020419 Length:385 Species:Caenorhabditis elegans


Alignment Length:299 Identity:65/299 - (21%)
Similarity:129/299 - (43%) Gaps:55/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DLERTREMANKRQHLLWEQQFYGVN--EYLGTP-------HLLLAFGQAIFSYDFSTSVKFGLST 156
            :::||.||.....:..:|....|:.  |..|.|       .|::   :.|...|.|......:..
 Worm    66 EMDRTSEMTPAVINGCFENGLMGIEVPEKYGGPGATFFDAALVI---EEISKVDASVGAMVDVHN 127

  Fly   157 GMFPSTLVSNGSGR-LGKYVAKIADNRILGAYALTEISHGTNALGMRTRATYDVKRQEFIIHTPD 220
            .:|...::..|:.: ..||:.|...:.: |::||:|...|::|..::|.|..|  ..:::|:   
 Worm   128 TLFIPLIIELGTEKQKEKYLPKCYTSSV-GSFALSETGSGSDAFALKTTAKKD--GDDYVIN--- 186

  Fly   221 FEAAKCWVGNLGKTCTHAIVYAQLYVPDDKHQGLQAFLVPIRDERTLLPFPGVTVGDMGEKIGLN 285
              .:|.|:.|..::.|. :|:|.. .|...::|:..|:|   ::.|    .|.|:|...:|:|:.
 Worm   187 --GSKMWISNSEQSETF-LVFANA-DPSKGYKGITCFIV---EKGT----KGFTIGKHEDKLGVR 240

  Fly   286 GIDNGFVMFNQYRIPKANLLSKTGDIDAQGNYTSKIKDERKRLGASLGALSVGRVNITAITYVAL 350
            ......:.|:..|:.|:.:|.:.|                |....::..|:.||:.|.| ..:.|
 Worm   241 SSSTCPLHFDNVRVHKSAILGEFG----------------KGYKYAIEYLNAGRIGIGA-QMLGL 288

  Fly   351 SKAVTIAT-RYAASRRQFGPTNSPAEWPVIEYQSQQYRL 388
            ::.....| .|...|.|||..       :|::|..|:::
 Worm   289 AQGCFDQTIPYLQQREQFGQR-------IIDFQGMQHQI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9527NP_001137800.1 ACAD 52..694 CDD:299127 65/299 (22%)
PLN02312 56..682 CDD:215178 65/299 (22%)
acdh-4NP_001300435.1 CaiA 41..359 CDD:224871 65/299 (22%)
ACAD 43..359 CDD:299127 65/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.