DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl6 and F41C6.4

DIOPT Version :9

Sequence 1:NP_609023.3 Gene:Nepl6 / 33893 FlyBaseID:FBgn0259716 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001129930.1 Gene:F41C6.4 / 185599 WormBaseID:WBGene00018278 Length:393 Species:Caenorhabditis elegans


Alignment Length:258 Identity:52/258 - (20%)
Similarity:85/258 - (32%) Gaps:86/258 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 RLMDSTDAEVVANYIM------------TRFVLYLID-DFIDSNEHIDCVTDMRRNMNLASNLL- 343
            |:...||:.....|::            ||.|..|:| :|....::|:...     ||:...|| 
 Worm   157 RVAKKTDSSHYQEYVLKLRENIAGWKNKTRAVNILLDGNFKVGVDNINSFL-----MNMVDVLLQ 216

  Fly   344 ----YKERFLDPATL-QQYT-----QEVTKVFEQLRR------QFLLQINENRLGLTSEQNSMVA 392
                ||....:|..| .|.|     |::.:..|.:.|      ::.:|:.||...|...:...:.
 Worm   217 WIQVYKYIAKNPFELILQETPWVNDQKINRALEAVARDLFVIDEYGIQLRENIDALMKTEQDFLK 281

  Fly   393 TKAQHVVLNIGNLPRGRDHRSFVSRHYEDLVFPLPDFDYAREHLNLLEFRTRKQVLQLNQSAPTP 457
            ..|                 .|..:|  ||...:..:.:      :...|| ..||.....|...
 Worm   282 CSA-----------------DFSGKH--DLFCSIYSYHF------MFNGRT-TTVLHFGYDATNR 320

  Fly   458 DEFFYLSDPKTAMSSGPYYLMRLNIIVVPHGLLQEPFFAADSHDIFKYSLLGFVLAHELMHSV 520
            ..:.|...|         ::.|                ||:|.......|.|:|:.|||.||:
 Worm   321 HPYIYFGMP---------FIAR----------------AANSEMAANLGLAGYVVGHELSHSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl6NP_609023.3 M13 42..653 CDD:189000 52/258 (20%)
F41C6.4NP_001129930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.