DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl4 and Nepl13

DIOPT Version :9

Sequence 1:NP_609019.1 Gene:Nepl4 / 33889 FlyBaseID:FBgn0031805 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_651096.1 Gene:Nepl13 / 42699 FlyBaseID:FBgn0039022 Length:741 Species:Drosophila melanogaster


Alignment Length:768 Identity:165/768 - (21%)
Similarity:280/768 - (36%) Gaps:241/768 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 INQQHIDTLMSYVDSEKNPCEDFYAYACGKWRAKHGSH------TTATMISESQINRQYEDLFLQ 100
            :.|:....:..|::...:||.||:.||||:|...|...      :||..:.|::|:.|.:    |
  Fly    52 VRQKIATDVQKYMNLSADPCTDFFEYACGQWGRYHKRQLRPDELSTAQQLMETKISEQLQ----Q 112

  Fly   101 LLRNPSAPEY---GY-----PMFAKVLAHYQSCIALE--KPDLRRYIE--LLDRDLLASLNSTHW 153
            ||..|..|::   ||     ....||.|.|:||:|:|  ..:.||::.  |.|...|.::.:::|
  Fly   113 LLTQPLPPQHHPNGYSGASMTNVRKVRAFYESCVAVEANASERRRFLMKILKDNGGLRNVPNSNW 177

  Fly   154 MH------LLAALGR-YGYH---GHYVQVEVRWYNATHHMIF-------LLPHNRHLNLSLTQ-- 199
            .|      .|..|.| ||..   |  :::::.......:.|:       ::| ..|.|...|:  
  Fly   178 QHNRQWVQTLGELRRNYGLDILLG--LEIDLNLQTMKGNTIYFGEPKLTIIP-AEHCNALATRGA 239

  Fly   200 ----DIYDALSQDGSSWPPLHQLQEQFRS-----------LEQNLVR-------------LAKPH 236
                ::|:.:.|         |:.|..|.           ...:::|             :.|| 
  Fly   240 QVRDEVYELVQQ---------QVTENLRDWFGMDTGEAARFAGDIIRFEFELCKQMGEQDIQKP- 294

  Fly   237 SADDTFRNYSLDQIRTEVPGLH---WDEALRTQLG-------RSVPGNHVFQVDDLDAIEGLVE- 290
              ::.|.    ..|:.::.|..   ..|.||.|.|       .|..|||   :|....:|.::| 
  Fly   295 --EEEFP----PAIQAQIYGARSRTGQERLRRQKGGMTLTELTSEMGNH---LDFKMLVEVILES 350

  Fly   291 ------YL-------NTVDTLLL-NRYSLARFLSH--LLELPHNPLATWESGQRSRGRNCIRHMR 339
                  ||       :.|.|:.. ||.::..::.:  |.||...|    |.....|.|.|::   
  Fly   351 QYPSQVYLRSPEYVKHVVRTVKANNRITVGGYILYVALNELNQPP----EEAPSQRARQCVQ--- 408

  Fly   340 RSVYLPMNYVYERSFYSRRRHADELVIHSVFQQ-LQSQLELRVQHNAFNLSQDLVKSLQAKVHQM 403
                     |.:|.|        ..|:..:||: :|..   ..:|:...:..|::|:|:      
  Fly   409 ---------VTQRLF--------PQVLGEMFQRHVQRD---NAKHDLDAVFNDVIKALE------ 447

  Fly   404 RINVGNLPPNVTEQFY--W--DSDRRWSVGRDFYENHLNSLLYYYTLVADLESSSDQEERDIW-- 462
                        |||:  |  ::|||  ..|.....:..||..|.:|  ||.....|:..|.|  
  Fly   448 ------------EQFHVEWMDENDRR--AARTRLSQYRVSLPDYQSL--DLTDLQFQKSEDYWRR 496

  Fly   463 ----YSFNMHTP----------EFPDNIDATPYFYCLG---NIIFVPYSYVKRPFFDANFWPALL 510
                ..:..|..          :..|.:||......|.   .::.|.:..::.|:::..:..:|.
  Fly   497 LEIALKYRSHQQFEALRGNDFGQDADGLDAFEVRAALSPRQQMVLVGWGLLQAPYYNYYYPKSLK 561

  Fly   511 YGDLANTLGHEIMHAFDTDLVDYDAQGNLRNFSDQLGEVEL--YNGAVGCLNS------------ 561
            |..|.:.|...::.|||.     :...|....:.|..||.:  |..|..|..:            
  Fly   562 YALLGHRLASALVQAFDD-----EGWNNHPQATAQWNEVTMSGYRNASECQRAQYSSYLYNEPGE 621

  Fly   562 --SAVMLNERTSDVSGSRLAMQTYGGDWLTRSG------------------NGRLYFLQFAHFFC 606
              :|..|.|..:|.||..||...|.. ||.:..                  |.:|:|:.||...|
  Fly   622 FRNATRLREIIADGSGLNLAFNAYLA-WLEQQDHKLRPLLAKETLSELNFTNTQLFFIYFAQTRC 685

  Fly   607 GDEGDQ----------YHDSGSQRLNYALGQVPQFAEVFRCHVGSGMTSADQC 649
            ..:.:|          .|......:|..|....:|...|.|.:|:.|.|.|:|
  Fly   686 WAKDNQDAILDSMPLMQHTPERWDVNGPLSNSAEFGREFGCALGTPMNSGDKC 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl4NP_609019.1 PepO 51..643 CDD:226118 160/751 (21%)
GluZincin 59..649 CDD:301352 162/749 (22%)
Nepl13NP_651096.1 PepO 63..732 CDD:226118 160/749 (21%)
M13 68..738 CDD:189000 162/750 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D282463at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.