DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl4 and Nepl7

DIOPT Version :10

Sequence 1:NP_609019.1 Gene:Nepl4 / 33889 FlyBaseID:FBgn0031805 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_609577.2 Gene:Nepl7 / 34671 FlyBaseID:FBgn0032442 Length:669 Species:Drosophila melanogaster


Alignment Length:46 Identity:11/46 - (23%)
Similarity:20/46 - (43%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 FPWGVVYSATK----FAVSGFMASLTEQLRIQGLSKSVRTTCVNPY 231
            :|..:..|..|    ...||:...|:  :.:|.|::...:|.|..|
  Fly   212 YPKKITVSVPKDPRRVMASGYQTGLS--ILLQPLAEDYHSTDVASY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl4NP_609019.1 GluZincin 59..649 CDD:472708 11/46 (24%)
Nepl7NP_609577.2 M13 52..666 CDD:341056 11/46 (24%)

Return to query results.
Submit another query.