powered by:
Protein Alignment Nepl4 and CG32762
DIOPT Version :9
Sequence 1: | NP_609019.1 |
Gene: | Nepl4 / 33889 |
FlyBaseID: | FBgn0031805 |
Length: | 652 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001284894.1 |
Gene: | CG32762 / 318198 |
FlyBaseID: | FBgn0052762 |
Length: | 200 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 13/63 - (20%) |
Similarity: | 19/63 - (30%) |
Gaps: | 24/63 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 LLLLGSATCGSSVPVKANDP-------EQSCPYL-----------------GECNSTINQQHI 47
:.||.|...|::.|.....| .::||.. |||....|..|:
Fly 12 MTLLWSMASGTTQPPSRRPPVTTARTTPRNCPLFPQVCSQTSPRVCGRTARGECQRFENICHL 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nepl4 | NP_609019.1 |
PepO |
51..643 |
CDD:226118 |
|
GluZincin |
59..649 |
CDD:301352 |
|
CG32762 | NP_001284894.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3590 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.