DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fibcd1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_849218.2 Gene:Fibcd1 / 98970 MGIID:2138953 Length:459 Species:Mus musculus


Alignment Length:297 Identity:98/297 - (32%)
Similarity:140/297 - (47%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LKSLYKLVLALLEENQSNAS---------TENIQKS--------SSDLNTTGLSGRYPSQC---- 81
            |:|....::.||.|:|.:.:         .|.:|:.        .:||......|..|..|    
Mouse   173 LQSEQGRLIQLLSESQGHMAHLVNSVSDVLEALQRERGLGRPRVKADLQRAPSRGARPRGCANGS 237

  Fly    82 ----------------------PTYPPAHGIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNK 124
                                  ||:.||            .|||.||....|.||||..||....
Mouse   238 RPRDCLDVLLSGQQDDGVYSIFPTHYPA------------GFQVYCDMRTDGGGWTVFQRREDGS 290

  Fly   125 LNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDE----IF-I 184
            :||||.|..|:.|||:|.|:.::||.::||:|....:||::.||||:..|.||||..    :| :
Mouse   291 VNFFRGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSV 355

  Fly   185 ESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFG 249
            :.|...|.:| :.:::|.||||::.:....|:|.|||:|....|||..|.||||:.||..|||.|
Mouse   356 DPEEDGYPLT-VADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNG 419

  Fly   250 IYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            .|::|....|..  |:.|.||....||.|..:|.:||
Mouse   420 QYLRGAHASYAD--GVEWSSWTGWQYSLKFSEMKIRP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 87/242 (36%)
Fibcd1NP_849218.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
FReD 239..455 CDD:238040 85/231 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 189 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm43923
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.