Sequence 1: | NP_609018.3 | Gene: | CG9500 / 33888 | FlyBaseID: | FBgn0031804 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001363692.1 | Gene: | ANGPTL1 / 9068 | HGNCID: | 489 | Length: | 491 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 75/199 - (37%) |
---|---|---|---|
Similarity: | 122/199 - (61%) | Gaps: | 2/199 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 GIYTVQVLGLK-PFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKL 152
Fly 153 HAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFST 217
Fly 218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQM 282
Fly 283 MVRP 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9500 | NP_609018.3 | FReD | 76..287 | CDD:238040 | 75/199 (38%) |
ANGPTL1 | NP_001363692.1 | PB1 | 74..138 | CDD:383100 | |
FReD | 275..490 | CDD:238040 | 75/199 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 186 | 1.000 | Domainoid score | I3350 |
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm40314 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.810 |