DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and ANGPTL1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:199 Identity:75/199 - (37%)
Similarity:122/199 - (61%) Gaps:2/199 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLK-PFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKL 152
            |||.::..... |.|:.|:..:...||||:.:||...:||||:|..||.|||.:||::::||:.:
Human   292 GIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENI 356

  Fly   153 HAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFST 217
            :.::....::|.|.|||:..:..||.|....:|.|::||.: :||.:.|:|||||:.:..:.|:|
Human   357 YMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRL-RLGTYQGNAGDSMMWHNGKQFTT 420

  Fly   218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQM 282
            .|||.|.:..|||..:.|.||:..|.:|||.|::.:|...:.....||.|..:|..|||.:.:||
Human   421 LDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQM 485

  Fly   283 MVRP 286
            |::|
Human   486 MIKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 75/199 (38%)
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100
FReD 275..490 CDD:238040 75/199 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.