DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angpt1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006241671.1 Gene:Angpt1 / 89807 RGDID:628896 Length:498 Species:Rattus norvegicus


Alignment Length:288 Identity:92/288 - (31%)
Similarity:135/288 - (46%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DTAIRNKPELKSL---YKLVLALLEENQSNASTEN--IQKSSSDLNTT-----------GL---S 74
            ||....|..|:.|   ...::..||:..|.|:..|  :||...:|..|           |:   .
  Rat   210 DTLKEEKENLQGLVTRQTFIIQELEKQLSRATNNNSVLQKQQLELMDTVHNLVSLCTKEGVLLKG 274

  Fly    75 GRYPSQCPTYPPA---------HGIYTVQVLGL-KPFQVSCDAEIAGTGWTVMARRTSNKLNFFR 129
            |:...:.|....|         .||||:....: :|.:|.|:.::.|.||||:..|....|:|.|
  Rat   275 GKREEEKPFRDCADVYQAGFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQR 339

  Fly   130 SWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMT 194
            .|.|||.|||...|::::|.:.:.|||..:.:.|.|.|.|:||...|:.||...|.:|.:.|.:.
  Rat   340 GWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLY 404

  Fly   195 KLGEFTGDAG-DSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQ 258
            ..|. ||.|| .|.:.....:|||.|.|||.....||....|.||...|..|||.|::....: .
  Rat   405 LKGH-TGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQ-N 467

  Fly   259 YFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            :.:..||.||.::..|||.:...||:||
  Rat   468 HGKLNGIKWHYFKGPSYSLRSTTMMIRP 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 76/222 (34%)
Angpt1XP_006241671.1 COG4372 <55..>255 CDD:226809 12/44 (27%)
FReD 281..496 CDD:238040 76/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.