DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and FCN3

DIOPT Version :10

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:184 Identity:70/184 - (38%)
Similarity:103/184 - (55%) Gaps:4/184 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHL 167
            |.||.:..|.||.|..||....::|||||:.|:.|||..:.:|::|.:.||.:|.....||.:.|
Human   119 VFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVEL 183

  Fly   168 EDFEGQTRYAHYDEIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFSTFDRDNDGWHKNCAE 231
            |||.|...:|||....:..|...|.:. ||:|: |.||||:..:..:.|:|:|.|:|..:.|||.
Human   184 EDFNGNRTFAHYATFRLLGEVDHYQLA-LGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAV 247

  Fly   232 EYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVR 285
            ...||||:.:|..|||.|.|...:...:..  ||.|.|.|...:.|:.::||:|
Human   248 IVHGAWWYASCYRSNLNGRYAVSEAAAHKY--GIDWASGRGVGHPYRRVRMMLR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 70/184 (38%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 69/182 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.