DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fgl2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:319 Identity:100/319 - (31%)
Similarity:138/319 - (43%) Gaps:90/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EENQSNASTENIQKSSSDLNTT-----GLSGRYPS------------------------------ 79
            |:|:.......:.|.||:|...     ||.||..|                              
  Rat   116 EDNRVQELESQVNKLSSELKNAKEEIQGLQGRLESLQLVNMNNIENYVDNKVANLTSVVNSLDSK 180

  Fly    80 --QCPTY------PPAHGIY----TVQVLGLK--------------PFQVSCDAEIAGTGWTVMA 118
              :||:.      |..|.||    ...|||.:              .|:|.||.|..|.||||:.
  Rat   181 CFKCPSQEHNQPNPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGGGWTVLQ 245

  Fly   119 RRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIF 183
            .|.....||.|.|.:||.|||.|:.:|::|.||:|.:|||:...|.|.||||.|.|.||.||:.:
  Rat   246 ARLDGSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFY 310

  Fly   184 IESENKFYAMTKLGEFTGDAGDSMIHNRNQN-----FSTFDRDNDGWHK-NCAEEYVGAWWHLNC 242
            :.:|...|.: .||.:.|.|||::..:|:.|     |:|.|||||.:.. ||...|...||...|
  Rat   311 VANEFLKYRL-HLGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDAC 374

  Fly   243 TYSNLFGIYVKGDEGQYFQWK------GIVWHSWRTES--------YSYKVMQMMVRPK 287
            ..:||        .|:|:..:      ||.|.:|...|        :|:|..:||:|||
  Rat   375 LSANL--------NGKYYHQRYKGVRNGIFWGTWPGVSQAHPGGYKFSFKKAKMMIRPK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 89/286 (31%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 11/60 (18%)
Fibrinogen_C 199..425 CDD:278572 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.