DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angptl1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_082609.2 Gene:Angptl1 / 72713 MGIID:1919963 Length:490 Species:Mus musculus


Alignment Length:206 Identity:77/206 - (37%)
Similarity:122/206 - (59%) Gaps:12/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 AHGIYTVQVLGLKP------FQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDF 145
            |.|||.:     ||      .|:.|:..:...||||:.:||...:||||:|..||.|||.:||::
Mouse   289 ASGIYMI-----KPENSNGLMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEY 348

  Fly   146 FIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHN 210
            ::|||.::.::....::|.|.|||:..:..||.|....:|.|:.:|.: :||.:.|:|||||:.:
Mouse   349 WLGLDNIYKLSNQDNYKLMIELEDWSEKKVYAEYSSFRLEPESDYYRL-RLGTYQGNAGDSMMWH 412

  Fly   211 RNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESY 275
            ..:.|:|.|||.|.:..|||..:.|.||:..|.:|||.|::.:|...:.....||.|..:|..||
Mouse   413 NGKQFTTLDRDKDTYTGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSY 477

  Fly   276 SYKVMQMMVRP 286
            |.:.:|||::|
Mouse   478 SLRAVQMMIKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 77/206 (37%)
Angptl1NP_082609.2 RILP-like 91..207 CDD:304877
FReD 274..489 CDD:238040 77/206 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43923
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.