powered by:
Protein Alignment CG9500 and Angptl1
DIOPT Version :9
Sequence 1: | NP_609018.3 |
Gene: | CG9500 / 33888 |
FlyBaseID: | FBgn0031804 |
Length: | 292 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102853.1 |
Gene: | Angptl1 / 679942 |
RGDID: | 1598128 |
Length: | 300 |
Species: | Rattus norvegicus |
Alignment Length: | 52 |
Identity: | 15/52 - (28%) |
Similarity: | 25/52 - (48%) |
Gaps: | 8/52 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 MDSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTE--NIQKSSSDLNT 70
||.|:.: |...|.|.|:. ||.|:.:...|...| .::|.|.::|:
Rat 82 MDLENLK-DVLSRQKREID-----VLQLVVDVDGNIVNEVKLLRKESRNMNS 127
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9500 | NP_609018.3 |
FReD |
76..287 |
CDD:238040 |
|
Angptl1 | NP_001102853.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
186 |
1.000 |
Domainoid score |
I3251 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2579 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm12326 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X25 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.810 |
|
Return to query results.
Submit another query.