DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angptl7

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001034643.1 Gene:Angptl7 / 654812 MGIID:3605801 Length:337 Species:Mus musculus


Alignment Length:266 Identity:90/266 - (33%)
Similarity:147/266 - (55%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ELKSLYKLVLALLEENQSNASTENIQ------KSSSDLNTTGLSGRYPSQCPT-YPPAH---GIY 91
            ||:|..|.:.:.|...:|..|..|.|      :::..:..|.....|  .|.: |...:   |:|
Mouse    74 ELESSSKHMESRLSTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIY--DCSSLYQKNYRISGVY 136

  Fly    92 TV---QVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLH 153
            .:   :.||....:|.||.|.:|.|||::.||.|..::|::.|.:||.|||.:.|||::|.:.:|
Mouse   137 KLPPDEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQGFGSIRGDFWLGNEHIH 201

  Fly   154 AITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAG-DSMIHNRNQNFST 217
            .:|: ||..|.:.|||:||..|||.|....:.:|...|.:. ||.::|:.| |:::::.|..|||
Mouse   202 RLTR-QPSRLRVELEDWEGNARYAEYSYFALGNELNSYRLF-LGNYSGNVGKDALLYHNNTVFST 264

  Fly   218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVK-GDEGQYFQWKGIVWHSWRTESYSYKVMQ 281
            .|:|||.....||:...|.:|:..||.|||.|:|.: |:..::..  ||.|:.|...:||.|.::
Mouse   265 KDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHRKHMD--GISWYGWHGANYSLKRVE 327

  Fly   282 MMVRPK 287
            |.:||:
Mouse   328 MKIRPE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 79/219 (36%)
Angptl7NP_001034643.1 FReD 120..332 CDD:238040 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.