DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and LOC594984

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001025596.1 Gene:LOC594984 / 594984 -ID:- Length:318 Species:Xenopus tropicalis


Alignment Length:200 Identity:82/200 - (41%)
Similarity:115/200 - (57%) Gaps:4/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLH 153
            |.||:......|..|.||.|..|.||.|..||....::||:.|..||.|||:.|.:|::|.:.||
 Frog   121 GWYTIYRPNGLPLPVFCDMETDGGGWIVFQRRKDGSVDFFQEWDSYKRGFGRQDSEFWLGNENLH 185

  Fly   154 AITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFST 217
            .:|.:...:|.:.|.||:....:|.|....|..|::.|.:: ||.|| ||||||:..::|:.||:
 Frog   186 LLTATGNFQLRVDLMDFDSNRTFASYSNFRIGGESRNYTLS-LGGFTGGDAGDSLSGHKNREFSS 249

  Fly   218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQM 282
            .|||||....:|||.|.||||:..|..|||.|:|:.|..|.:.  .|:.|.|....:|||||.:|
 Frog   250 KDRDNDSSPTSCAERYKGAWWYSGCHTSNLNGLYLGGKHGSFA--NGVNWKSGGGYNYSYKVSEM 312

  Fly   283 MVRPK 287
            ..||:
 Frog   313 KFRPQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 81/198 (41%)
LOC594984NP_001025596.1 Collagen 42..99 CDD:189968
FReD 107..316 CDD:238040 80/197 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.