DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angptl4

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_065606.2 Gene:Angptl4 / 57875 MGIID:1888999 Length:410 Species:Mus musculus


Alignment Length:312 Identity:82/312 - (26%)
Similarity:145/312 - (46%) Gaps:64/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQ----KSSSDL---------------- 68
            :|.|.....:|. :::.|::.|    .:.|...|.:|::    :|..||                
Mouse   107 QSLQTQLKAQNS-KIQQLFQKV----AQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRG 166

  Fly    69 ----NTTGLSGRYPSQCPTYPPAH-------------GIYTVQVLGLKPFQVSCDAEIAGTGWTV 116
                ..|.|.|..|:....:.|..             |::.:|.||..||.|:|:....| ||||
Mouse   167 KRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDG-GWTV 230

  Fly   117 MARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDE 181
            :.||.:..::|.:||..||:|||...|:|::||:|:|:||.::..:|.:.|:|::|..:...: .
Mouse   231 IQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQF-P 294

  Fly   182 IFIESENKFYAMTKLGEFTGDAGDSMI--HNRNQNFSTFDRDND-GWHKNCAEEYVGAWWHLNCT 243
            |.:..|:..|::........:.|.:.:  :..:..|||:|:|:| ....|||:...|.||...|:
Mouse   295 IHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCS 359

  Fly   244 YSNLFGIYVKGDEGQYF---------QWKGIVWHSWRTESYSYKVMQMMVRP 286
            :|||        .||||         :.|||.|.:|:...|..:...::::|
Mouse   360 HSNL--------NGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 68/236 (29%)
Angptl4NP_065606.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..101
Fib_alpha <104..133 CDD:285864 6/30 (20%)
FReD 187..404 CDD:238040 67/227 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.