DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and angptl2a

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001025401.1 Gene:angptl2a / 569092 ZFINID:ZDB-GENE-080721-15 Length:525 Species:Danio rerio


Alignment Length:264 Identity:94/264 - (35%)
Similarity:137/264 - (51%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QSNASTENIQKSSSDLNTTGLSGRYPSQCPT-YPPAHGIYTVQVLG------------------- 97
            |:|..|..||   ||.|:..:    ||..|| ....|...|.::.|                   
Zfish   267 QNNQMTNEIQ---SDQNSKAM----PSALPTEQSETHSFSTDKLSGPFKDCLQALEEGHSNSGMF 324

  Fly    98 -LKP------FQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAI 155
             |||      .||.||......||||:.||....:||||:|..||.|||.:||::::||:.::.:
Zfish   325 LLKPENTNKLMQVWCDQRHDPGGWTVIQRRMDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWL 389

  Fly   156 TKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDR 220
            |....::|.:.|||:.|:..:|.|....:|.|..||.| ::|.:.|:|||||..:..:.|:|.||
Zfish   390 TNQGNYKLLVTLEDWSGRKTFAEYASFRLEPEADFYKM-RVGRYHGNAGDSMTWHNGKQFTTLDR 453

  Fly   221 DNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQY---FQWKGIVWHSWRTESYSYKVMQM 282
            |:|.:..|||....|.||:..|.:|||.|::.:|  |.|   :| .|:.|..:|..|||.|.:.|
Zfish   454 DHDAYTGNCAHYQKGGWWYNACAHSNLNGVWYRG--GHYRSRYQ-DGVYWAEFRGGSYSLKKVTM 515

  Fly   283 MVRP 286
            |:||
Zfish   516 MIRP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 86/241 (36%)
angptl2aNP_001025401.1 DUF1875 <50..>147 CDD:286100
Fib_alpha 119..215 CDD:285864
FReD 305..519 CDD:238040 78/217 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.