DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and fibcd1b

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:318 Identity:105/318 - (33%)
Similarity:150/318 - (47%) Gaps:69/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MDSESFQNDTAI--RNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLN-----TTGL----- 73
            ||.||.:...:.  ::...|::....::.||.|:|.| ..:.:...|..||     |.||     
Zfish   184 MDYESLRRGQSNLGQDLNTLQTEQSRLIQLLSESQIN-MVKVVNSVSDALNAMQKETGGLKARVK 247

  Fly    74 -----------------SGRYPSQC-----------------PTYPPAHGIYTVQVLGLKPFQVS 104
                             :|..|..|                 ||:.||            .|||.
Zfish   248 ADLQRAPVRGVRLKGCANGSRPRDCSDIYASGQREDGIYSVFPTHYPA------------GFQVY 300

  Fly   105 CDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLED 169
            ||....|.||||:.||....:||||.|..|:.|||::.|::::||.::||::....:||.|.|||
Zfish   301 CDMSTDGGGWTVIQRREDGSVNFFREWDSYREGFGKITGEYWLGLKQIHALSIQGNYELRIDLED 365

  Fly   170 FEGQTRYAHYDEIF------IESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKN 228
            ||..|.:|.|. :|      ::.|:..|.:| :.::||.||||::.:....|:|.|||||....|
Zfish   366 FENSTAFAQYG-VFGVGLFSVDPEDDGYPLT-IADYTGTAGDSLLKHNGMKFTTKDRDNDHSENN 428

  Fly   229 CAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            ||..|.||||:.||..|||.|.|::|....|..  ||.|.||....||.|..:|.:||
Zfish   429 CASFYHGAWWYRNCHTSNLNGQYLRGQHTSYAD--GIEWSSWTGWQYSLKFTEMKIRP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 88/234 (38%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H122246
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.