DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and fgl2a

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001020710.1 Gene:fgl2a / 565637 ZFINID:ZDB-GENE-030131-9506 Length:451 Species:Danio rerio


Alignment Length:324 Identity:99/324 - (30%)
Similarity:156/324 - (48%) Gaps:72/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DSESFQN--------DTAIRN-KPELKSLYKLVLALLEE-NQSN-ASTENIQKSSSDLNTTGLSG 75
            |::..||        .::::| :.::.||.    ..||| |..| .:.|||.....: |.||:..
Zfish   138 DNDIVQNMQVKMNRMSSSLKNARAQINSLQ----GRLEELNLLNLQNVENIVDRKVE-NITGMVN 197

  Fly    76 RYPSQCPTYP------------PAHGIYTVQVLGLK--------------PFQVSCDAEIAGTGW 114
            :..|.|.:.|            |......:.:||.:              .|.|.||.|..|.||
Zfish   198 KISSTCTSCPGQQLQLQHLTNIPPRDCSDISMLGQRINKVYQVTPDPRNGSFAVYCDMESFGGGW 262

  Fly   115 TVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHY 179
            ||:..|.:..::|.|:||:||.|||.|:.:|::|.||:|.:||::...|.|.|||.||...||.|
Zfish   263 TVIQHRINGSVSFNRTWADYKKGFGNLNSEFWLGNDKIHLLTKAKDMILRIELEDSEGTRGYAKY 327

  Fly   180 DEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQN-----FSTFDRDNDGWHK-NCAEEYVGAWW 238
            |:.::.:|...|.::..| ::|.||:::..:::.|     |:|.|:|||.:.. ||...|...||
Zfish   328 DQFYVSNEFLHYRLSVSG-YSGTAGNALQFSKHFNHDQKFFTTPDKDNDRYPSGNCGAYYGSGWW 391

  Fly   239 HLNCTYSNLFGIYVKGDEGQYFQWK------GIVWHSW--RTESY-------SYKVMQMMVRPK 287
            ...|..:||        .|:|::.|      ||.|.:|  .|..|       :||.::||:|||
Zfish   392 FDACMSANL--------NGKYYKTKYKGKRDGIFWGTWPNATSEYYPTSFRQAYKNVKMMIRPK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 80/257 (31%)
fgl2aNP_001020710.1 FReD 219..447 CDD:238040 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.