DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and si:ch211-203k16.3

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_021324371.1 Gene:si:ch211-203k16.3 / 559151 ZFINID:ZDB-GENE-041014-290 Length:425 Species:Danio rerio


Alignment Length:210 Identity:84/210 - (40%)
Similarity:117/210 - (55%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYT-VQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKL 152
            |||| |..||..|.:|.||.:..|.||||:.||....:||.|||.|||.|||.|..::::|.:.:
Zfish   217 GIYTVVPSLGAMPVEVYCDMDTDGGGWTVIQRRQDGSVNFDRSWKEYKEGFGDLHTEYWLGNEHI 281

  Fly   153 HAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSM--IHNRNQNF 215
            |.:|....:.|.|.|||:..:.::|.|....:|.||..|.:...| |:|...||.  .|:: |.|
Zfish   282 HDLTSQGDYMLRIDLEDWSNKHKHALYQSFSVEDENTQYRLHVSG-FSGTVEDSFSWYHDK-QGF 344

  Fly   216 STFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQY-FQWK------GIVWHSWR-T 272
            ||.|..|     .|||.....||:..|.|:||.|||.||  |:| .:.|      |:||.:|: :
Zfish   345 STPDTGN-----ICAEISHAGWWYNQCFYTNLNGIYYKG--GRYSLKGKNSLGPDGVVWFTWKDS 402

  Fly   273 ESYSYKVMQMMVRPK 287
            :.||.:.:.||:|||
Zfish   403 DYYSLRRVSMMIRPK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 82/208 (39%)
si:ch211-203k16.3XP_021324371.1 SMC_N 73..>158 CDD:330553
FReD 202..417 CDD:238040 82/208 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.