DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and MGC107780

DIOPT Version :10

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001015692.1 Gene:MGC107780 / 548409 XenbaseID:XB-GENE-29099131 Length:308 Species:Xenopus tropicalis


Alignment Length:200 Identity:81/200 - (40%)
Similarity:112/200 - (56%) Gaps:4/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLH 153
            |.|.:...|.:|..|.||.:..|.||.|..||....::|||.|..||.|||....:|::|.|.:|
 Frog   112 GWYKIYPDGERPLTVLCDMDTDGGGWIVFQRRWDGSVDFFRDWDSYKKGFGSQLSEFWLGNDNIH 176

  Fly   154 AITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFST 217
            .:|.:..::|.|...|||.|..:|.||......|...|.:. ||.:: |.||||:.|:||..|||
 Frog   177 TLTSAGTYKLRIDFTDFENQNSFAAYDSFATLGEKDNYKLI-LGAYSGGTAGDSLNHHRNCPFST 240

  Fly   218 FDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQM 282
            .|||||..:.|||:.:.|.||:.:|..|||.|:|::|....  :..||.|.:.:...|||||.:|
 Frog   241 KDRDNDFHNINCADTFKGGWWYGSCHDSNLNGLYLRGKHSN--EALGINWETGKGNGYSYKVTEM 303

  Fly   283 MVRPK 287
            ..|||
 Frog   304 KFRPK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 79/198 (40%)
MGC107780NP_001015692.1 Collagen 40..>72 CDD:460189
FReD 98..308 CDD:238040 79/198 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.