DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and angptl1a

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001014820.1 Gene:angptl1a / 544656 ZFINID:ZDB-GENE-040724-269 Length:480 Species:Danio rerio


Alignment Length:284 Identity:88/284 - (30%)
Similarity:138/284 - (48%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQCPT-----YPP--------- 86
            |.:..|.::|...:..| :|..|..||:   |.|............||     .||         
Zfish   203 PAVPPLVQVVPESIPAN-NNRFTNEIQR---DNNNRAFPRGSRMDTPTPDPLGIPPPPQGTLTAD 263

  Fly    87 ---------------AHGIYTVQVLGL-KPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYK 135
                           ..|:|.::..|. :..|..|:.::...||||..||....:||||:|..||
Zfish   264 GPFKDCSQVRQAGHSTSGMYLLKAEGSDRLIQAWCEHKLDNGGWTVFQRRKDGSVNFFRNWENYK 328

  Fly   136 NGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFT 200
            .|||.:||:.::||:.::.:.|...::|.:.|||:.|:..||.|....:|.|::.:.: :||.:.
Zfish   329 KGFGNIDGEHWLGLENIYNLAKQGDYKLLVELEDWVGKKVYAEYSSFHLEPESEGFRL-RLGTYQ 392

  Fly   201 GDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQY---FQW 262
            |:||||:..:..:.|:|.|||.|.:..|||..:.|.||:..|..:||.|::..|  |.|   || 
Zfish   393 GNAGDSLTSHNGKPFTTLDRDKDAFTGNCAHFHKGGWWYNACGQTNLNGVWYSG--GVYRSKFQ- 454

  Fly   263 KGIVWHSWRTESYSYKVMQMMVRP 286
            .||.|..:....||.|.::||:||
Zfish   455 DGIFWAEYGGGYYSLKSVRMMIRP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 78/244 (32%)
angptl1aNP_001014820.1 FReD 264..479 CDD:238040 74/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.