DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angptl3

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006238502.1 Gene:Angptl3 / 502970 RGDID:1564505 Length:455 Species:Rattus norvegicus


Alignment Length:308 Identity:86/308 - (27%)
Similarity:138/308 - (44%) Gaps:52/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QNDTAIRNKPELKSLYKLV----------LALLEENQSNASTENIQ--KSSSDLNTTGL-----S 74
            ||....|..||:.||...|          |..:||.....|.::||  :..:.|..||:     :
  Rat   150 QNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTEN 214

  Fly    75 GRY--PSQCPTYPPAH---------------------------GIYTVQVLGLKPFQVSCDAEIA 110
            ..|  |....|.||.|                           |:||::....:.|.|.||.: :
  Rat   215 SLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQ-S 278

  Fly   111 GTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTR 175
            ||..|::..|.....||.::|..|:.|||:|||:|::||:|::||.|...:.|.:.|:|::....
  Rat   279 GTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGEFWLGLEKIYAIVKQSNYILRLELQDWKDSKH 343

  Fly   176 YAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHL 240
            ||.| ...:.:....|.: .:.|...:..:::..:|:..|||:|....| ...|.|.|.|.||..
  Rat   344 YAEY-SFHLGNHETNYTL-HVAEIAANIPEALPEHRDLMFSTWDHRAKG-QLYCPESYSGGWWFS 405

  Fly   241 N-CTYSNLFGIYVK-GDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            : |..:||.|.|.| ..:.:..:.:||.|.....:.||.|..:||::|
  Rat   406 DMCGENNLNGKYNKPRAKSKPERRRGISWRPRGGKLYSIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 69/242 (29%)
Angptl3XP_006238502.1 SPEC <34..193 CDD:295325 12/42 (29%)
FReD 241..453 CDD:238040 62/215 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.