DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and angptl4

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001243132.1 Gene:angptl4 / 492647 ZFINID:ZDB-GENE-041111-222 Length:460 Species:Danio rerio


Alignment Length:283 Identity:87/283 - (30%)
Similarity:141/283 - (49%) Gaps:35/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EAMDSE-----SFQNDTAIRNKPELKSLYKLVLALLEENQS-NASTENIQKSS-----SDLNTTG 72
            |.:|.:     :.||...::|:       :|.|..:||:.: |||||  |:.|     ||.:...
Zfish   191 EKLDKQNIRIRTLQNQITMKNE-------RLSLKRMEEDVNLNASTE--QRDSPVALASDCHELF 246

  Fly    73 LSGRYPSQCPTYPPAHGIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNG 137
            |.|...|         |:||:|....:||:|.|:....| ||||:.||....::|.:.|..|:||
Zfish   247 LRGETSS---------GLYTIQPSDSQPFEVYCEMTPEG-GWTVIQRRQDGSVDFDQLWQAYQNG 301

  Fly   138 FGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGD 202
            ||.|:|:|::||:|:|:::|...:.|.:...|:..:.:...| ...:..:...|::..|....|:
Zfish   302 FGNLNGEFWLGLEKIHSVSKGGNYILKVQFSDWRDEIQSISY-RFHLNGQENNYSLRILESPAGN 365

  Fly   203 AGDSM-IHNRNQNFSTFDRDNDGWHK-NCAEEYVGAWWHLNCTYSNLFGIY--VKGDEGQYFQWK 263
            ...|: .......|||.|:|||..:. |||::..|.||..||..|||.|.|  ....:.::.:.:
Zfish   366 TESSLPTETSAVPFSTRDKDNDQKNDLNCAKQLSGGWWFSNCGRSNLNGRYFVTPAPKQRHQRKQ 430

  Fly   264 GIVWHSWRTESYSYKVMQMMVRP 286
            |:.|.:||...|..|...||:.|
Zfish   431 GVFWKTWRGRYYPLKTTTMMIAP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 67/215 (31%)
angptl4NP_001243132.1 DUF4795 78..>224 CDD:292662 9/39 (23%)
FReD 240..453 CDD:238040 70/223 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.