DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and col11a2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001005799.1 Gene:col11a2 / 448277 XenbaseID:XB-GENE-12564499 Length:340 Species:Xenopus tropicalis


Alignment Length:243 Identity:87/243 - (35%)
Similarity:126/243 - (51%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNTTGLSGRYPSQCPTYPPAH-----------------GIYTVQVLGLKPFQVSCDAEIAGTGWT 115
            |...|..|......|:.||..                 |.||:.:.|.||.:|.||.:..|.||.
 Frog   104 LGPRGEKGDMGPPGPSGPPGERAAKNCMELLNYGVLFTGWYTIYLDGNKPIKVLCDMDTDGGGWI 168

  Fly   116 VMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYD 180
            |..||....::|:|.|..||.|||....:|::|.:.:|.:|.|...:|...||||:....||.|.
 Frog   169 VFQRRVDGSVDFYRDWKSYKQGFGSQLSEFWLGNENIHRLTSSGNFQLRFDLEDFDNNRTYATYS 233

  Fly   181 EIFIESENKFYAMTKLGEFT-GDAGDSMIHNRNQNFSTFDRDNDGWHK-NCAEEYVGAWWHLNCT 243
            :..:|.|::.|.: :..||| |.||||:..::::.|||.|.|||...| ||||.|.||||:.:|.
 Frog   234 QFRLEPESQNYTL-RFREFTGGPAGDSLFTHKDRAFSTKDADNDPASKTNCAERYKGAWWYESCY 297

  Fly   244 YSNLFGIYVKGD----EGQYFQWKGIVWHSWRTESYSYKVMQMMVRPK 287
            :|.|.|.|::|.    :|      |:.|..:|..:||.||.:|.:||:
 Frog   298 HSCLNGEYMRGQHDKADG------GVHWAKFRGVNYSLKVSEMKLRPE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 83/233 (36%)
col11a2NP_001005799.1 Collagen 45..110 CDD:189968 2/5 (40%)
FReD 128..338 CDD:238040 79/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3986
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.