DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and MFAP4

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001185624.1 Gene:MFAP4 / 4239 HGNCID:7035 Length:279 Species:Homo sapiens


Alignment Length:203 Identity:79/203 - (38%)
Similarity:111/203 - (54%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLK-PFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKL 152
            |:|.:...|.. |..|.||....|..|||..:|.:..::|||.|.:||.|||:.||::::||..:
Human    77 GVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNM 141

  Fly   153 HAITKSQPHELYIHLEDFEGQTRYAHYDEIFI-----ESENKFYAMTKLGEFTGDAGDSMIHNRN 212
            |.:|..|.:||.:.|||||..|.||.|.:..|     .:|...|.:...|...|.||||:.::..
Human   142 HLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSG 206

  Fly   213 QNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSY 277
            |.|||||||.|.:.:|||....||:|..:|.::||.|.|:.|....|.  .||.|..|:...||.
Human   207 QKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYA--NGINWAQWKGFYYSL 269

  Fly   278 KVMQMMVR 285
            |..:|.:|
Human   270 KRTEMKIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 79/203 (39%)
MFAP4NP_001185624.1 FReD 60..278 CDD:238040 79/203 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3350
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3915
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm40314
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.