DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and CG9593

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster


Alignment Length:191 Identity:65/191 - (34%)
Similarity:94/191 - (49%) Gaps:16/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 CDAEIAGTGWTVMARRTSN---KLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIH 166
            |.....|..|||:..|..:   ..||.|||.||:.|||.|..||:.|.:..|.|.....|||.|.
  Fly   187 CAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIE 251

  Fly   167 LEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWH----- 226
            |::......:|.|...:::||:..|.::..|||.|...|::..:...:|||:||..:  |     
  Fly   252 LQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRN--HAKSAD 314

  Fly   227 KNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWK-GIVWHSWRTESYSYKVMQMMVRP 286
            ..|.|:|.|.||...||..||     .|:.|.:.:.. .|:|.:|||.:...|..:||:||
  Fly   315 STCGEDYGGGWWFDRCTQCNL-----NGEHGVHQRASPAIIWMNWRTGTDKPKSSRMMIRP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 65/191 (34%)
CG9593NP_650493.2 FReD 150..371 CDD:238040 65/191 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.