Sequence 1: | NP_609018.3 | Gene: | CG9500 / 33888 | FlyBaseID: | FBgn0031804 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_919364.1 | Gene: | tnr / 369191 | ZFINID: | ZDB-GENE-030804-1 | Length: | 1350 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 78/203 - (38%) |
---|---|---|---|
Similarity: | 117/203 - (57%) | Gaps: | 15/203 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 GIYTVQV-----LGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIG 148
Fly 149 LDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQ 213
Fly 214 NFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYK 278
Fly 279 VMQMMVRP 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9500 | NP_609018.3 | FReD | 76..287 | CDD:238040 | 78/203 (38%) |
tnr | NP_919364.1 | EGF_2 | 199..225 | CDD:285248 | |
EB | 234..283 | CDD:279949 | |||
EGF_2 | 294..318 | CDD:285248 | |||
fn3 | 323..401 | CDD:278470 | |||
fn3 | 411..490 | CDD:278470 | |||
fn3 | 500..579 | CDD:278470 | |||
FN3 | 590..674 | CDD:238020 | |||
fn3 | 682..754 | CDD:278470 | |||
fn3 | 771..849 | CDD:278470 | |||
FN3 | 859..935 | CDD:214495 | |||
fn3 | 949..1019 | CDD:278470 | |||
fn3 | 1035..1103 | CDD:278470 | |||
FReD | 1126..1336 | CDD:238040 | 78/203 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100073 | |
Panther | 1 | 1.100 | - | - | O | PTHR19143 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |