DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and CG8642

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster


Alignment Length:299 Identity:112/299 - (37%)
Similarity:159/299 - (53%) Gaps:35/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TEAMDSESFQNDTAIRNK----PELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRY- 77
            |:...::.....|||:.|    .||:...|:....|:..|...:.......||.|....|.|:. 
  Fly   121 TQVCSAQQSSFTTAIKEKDEQIKELEQKVKVYETRLKRKQHVLAELRKLNGSSALLIEHLKGKVV 185

  Fly    78 --------------------PSQCPTYPPAHGIYTVQVLGLKPFQVSCDAE-IAGTGWTVMARRT 121
                                .:.|..:..:.||:.:.:.|..||.|.|:.: .||.|||.:.||.
  Fly   186 YFERKFREKKDDLLADWEAATTSCVPFGRSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRL 250

  Fly   122 SNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIES 186
            ...:||:|:|..|..|||:|:|:|||||:|||.:|.||||||||.:..|.|:|.|||||:..|.|
  Fly   251 DGSVNFYRNWDAYSKGFGKLNGEFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGS 315

  Fly   187 ENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGW-HKNCAEEYVGAWWHLNCTYSNLFGI 250
            |.:.|.:..||.:.|:|.|::..:....|||:|||||.: |.||||.:.||||:..|:.|||.|.
  Fly   316 EEEGYELKLLGHYQGNASDALRTHDKMKFSTYDRDNDAFTHMNCAEHHQGAWWYDFCSRSNLNGR 380

  Fly   251 YVKG--DEGQYFQWKGIVWHSWRTESYSYKVMQMMVRPK 287
            |.||  |..|...|:  .|:|:|    |.|.:||::|||
  Fly   381 YFKGEVDNPQSIYWE--PWYSFR----SLKSVQMLIRPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 95/235 (40%)
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 10/41 (24%)
FReD 213..413 CDD:238040 94/205 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 187 1.000 Domainoid score I3330
eggNOG 1 0.900 - - E1_KOG2579
Homologene 1 1.000 - - H122246
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D49112at7147
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
1110.870

Return to query results.
Submit another query.