DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and fgb

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_997939.1 Gene:fgb / 337315 ZFINID:ZDB-GENE-030131-9261 Length:485 Species:Danio rerio


Alignment Length:327 Identity:87/327 - (26%)
Similarity:148/327 - (45%) Gaps:72/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TEAMDSE-SFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQ- 80
            |:::::: ::..||.....|:   ..|::..:|::.:     |.||:....:.|.....:.|.: 
Zfish   168 TDSLETQHAYIKDTVDVTFPQ---NIKVLQGVLDKIR-----EKIQRLEKAITTQRAKCQAPCKV 224

  Fly    81 -CPTYPPAHG---------------IYTVQ--VLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNF 127
             || .|...|               :|.::  .|| .|::|.||......||.::..|....::|
Zfish   225 TCP-IPVVSGKECEDIIRKGGEDSQMYIIRPDPLG-TPYKVFCDQTSKNGGWVLIQNRMDGSVDF 287

  Fly   128 FRSWAEYKNGFG-----------QLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDE 181
            .|.|.:|:.|||           |..|::::|.|::..::|....||.:.:||:.|...||.|::
Zfish   288 GRRWDDYRRGFGNIAFDVGKGHCQTPGEYWLGNDRISQLSKMGATELLVEMEDWSGSKVYAQYEQ 352

  Fly   182 IFIESENKFYAMTKLGEFTGDAGDSM---------------IHNRNQNFSTFDRDNDGW-----H 226
            ..::.|...|.: .:|.::|.||::.               ||| ...|||:|||||.|     .
Zfish   353 FSMQGEASNYIL-GVGRYSGTAGNTFLEGATELFGENRTMTIHN-GMMFSTYDRDNDKWIPGDPS 415

  Fly   227 KNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQW-------KGIVWHSWRTESYSYKVMQMMV 284
            |.|::|..|.||:..|...|..|.|..|  |.|.::       .||||.:|:...||.|.:.|.:
Zfish   416 KQCSKEDGGGWWYNRCHSCNPNGRYYWG--GAYTKYMAKHGTDDGIVWMNWKGSWYSLKTISMKI 478

  Fly   285 RP 286
            ||
Zfish   479 RP 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 77/268 (29%)
fgbNP_997939.1 Fib_alpha 87..229 CDD:285864 13/69 (19%)
FReD 232..481 CDD:294064 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.