DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and wu:fj11g02

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001373547.1 Gene:wu:fj11g02 / 335430 ZFINID:ZDB-GENE-030131-7370 Length:246 Species:Danio rerio


Alignment Length:242 Identity:79/242 - (32%)
Similarity:125/242 - (51%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LKSLYKLVL--ALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQCPTYPPAHGIYTVQVLGLKP 100
            |.:|..:||  ...|:..|.....:::|:...|:                   |:||:...|..|
Zfish     8 LVALLSIVLVNGCSEDEDSPVDCSDLKKAGETLS-------------------GVYTIHPAGETP 53

  Fly   101 FQVSCDAEIAGT-----GWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQP 160
            ..|.|.....|.     ||||..||....:||:|.|.:||.|||.::|::::||:.|:.:|:.:.
Zfish    54 VWVYCQMVSDGKDEENGGWTVFQRRMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKK 118

  Fly   161 HELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGW 225
            ..|.:.||||.|:..:|.|....:..|...|.:...|...|.|||||.::....|||||:|.|.:
Zfish   119 FMLRVDLEDFTGRKGFAQYSSFSVGCETDGYKLQVSGFKDGGAGDSMTYHNGMKFSTFDKDQDNF 183

  Fly   226 HKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRT 272
            .|:||..|:||:|:.||.::||.|:|:.|::...|. .|.||:.|::
Zfish   184 DKSCARLYLGAFWYNNCHHANLNGVYLWGEDATIFA-IGNVWYGWKS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 71/202 (35%)
wu:fj11g02NP_001373547.1 FReD 25..243 CDD:238040 74/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.