DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and tnn

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_005171321.1 Gene:tnn / 30234 ZFINID:ZDB-GENE-990415-262 Length:1020 Species:Danio rerio


Alignment Length:267 Identity:84/267 - (31%)
Similarity:132/267 - (49%) Gaps:21/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TAIRNKPELKSL---YKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQCPTY----PPA 87
            ||..|:..|..|   .|.::.|:....|..|    :...:..:|.||:.::|..|...    ...
Zfish   747 TARENRFALSGLEMGKKYIVTLIAYRGSKRS----KIVETTFSTVGLAYQFPMDCTQIMRNGNME 807

  Fly    88 HGIYTVQVLG--LKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLD 150
            .|:||:.|..  .:..||.||.:..|.||.|..||.:.|::|.:.|.:|..|||:|..:|::|||
Zfish   808 SGVYTIYVNNNRSRTMQVYCDMKTDGGGWIVFQRRNTGKVDFMKKWRDYMKGFGELTEEFWLGLD 872

  Fly   151 KLHAITKSQPHELYIHLEDFEGQTR-YAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQN 214
            |:|.:|.: |.:.....:...|..| ||.||...:....:.:.:| :|.:.|:|||:|.:::...
Zfish   873 KIHELTNT-PTQYEARFDLGSGSDRKYAVYDNFKVAPSKQKFKLT-IGSYKGNAGDAMTYHQGAP 935

  Fly   215 FSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKV 279
            |||.|.|||....|||..:.||||:.||..:||.|.:  ||.....   |:.|..|:....|...
Zfish   936 FSTVDSDNDIALGNCALTHQGAWWYKNCHLANLNGRF--GDNRHSM---GVNWEPWKGHLQSLDF 995

  Fly   280 MQMMVRP 286
            .::.:||
Zfish   996 AEIKIRP 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 72/218 (33%)
tnnXP_005171321.1 EGF_alliinase <133..163 CDD:282688
EGF_2 161..189 CDD:285248
EGF_2 193..220 CDD:285248
EGF_2 224..251 CDD:285248
fn3 257..333 CDD:278470
fn3 344..426 CDD:278470
fn3 435..514 CDD:278470
fn3 523..602 CDD:278470
fn3 611..683 CDD:278470
fn3 699..773 CDD:278470 7/25 (28%)
FReD 792..1003 CDD:238040 72/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.