DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Angpt4

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001099996.1 Gene:Angpt4 / 296269 RGDID:1307539 Length:508 Species:Rattus norvegicus


Alignment Length:280 Identity:86/280 - (30%)
Similarity:132/280 - (47%) Gaps:30/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YSTEAMDSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQ 80
            :|..|:.|.|   .:..:.:.:|..|.:.::.::.::|...|.:..:....|......||...| 
  Rat   247 HSLRALSSNS---SSLQQQQQQLMELVQRLVRIVAQDQHPVSLKTPKPLFRDCAEIKRSGANTS- 307

  Fly    81 CPTYPPAHGIYTVQVLGL-KPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGD 144
                    |:||:....: ||.:|.||.|..|.|||::.||....|||.|:|.|||.|||.:..:
  Rat   308 --------GVYTIHGANMTKPLKVFCDMETDGGGWTLIQRREDGSLNFQRTWEEYKEGFGNVARE 364

  Fly   145 FFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIH 209
            .::|.:.:|::|....:.|.:.|.|:||......|:...:.||.:.|:::        ..||.|.
  Rat   365 HWLGNEAVHSLTSRTAYLLRVELHDWEGHQTSIQYENFQLGSERQRYSLS--------VNDSSIS 421

  Fly   210 NRNQN--------FSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIV 266
            .|.:|        |||.|.|||.....||:...|.||...|..|||.|||....: ...:..||.
  Rat   422 ARLKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYPVHQ-HLHKINGIR 485

  Fly   267 WHSWRTESYSYKVMQMMVRP 286
            ||.:|..|||....:||:||
  Rat   486 WHYFRGPSYSLHGTRMMLRP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 75/220 (34%)
Angpt4NP_001099996.1 FReD 291..506 CDD:238040 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.