DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Mfap4

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006246622.1 Gene:Mfap4 / 287382 RGDID:1307841 Length:281 Species:Rattus norvegicus


Alignment Length:227 Identity:80/227 - (35%)
Similarity:111/227 - (48%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GIYTVQVLGLK-PFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDF------- 145
            |:|.:...|.. |..|.||....|..|||..:|.:..::|||.|.:||.|||:.||::       
  Rat    55 GVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGKVGS 119

  Fly   146 -----------------FIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFI-----ESEN 188
                             ::||..||.:|..|.:||.:.|||||..|.||.|.:..|     .:|.
  Rat   120 WGGGCPLANSWLTSCHPYLGLQNLHLLTLKQKYELRVDLEDFENNTAYAKYVDFSISPNAVSAEE 184

  Fly   189 KFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVK 253
            ..|.:...|...|.||||:.::..|.|||||||.|.:.:|||....||:|..:|.::||.|.|:.
  Rat   185 DGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLG 249

  Fly   254 GDEGQYFQWKGIVWHSWRTESYSYKVMQMMVR 285
            |....|.  .||.|..|:...||.|..:|.:|
  Rat   250 GSHLSYA--NGINWAQWKGFYYSLKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 80/227 (35%)
Mfap4XP_006246622.1 FReD 38..280 CDD:238040 80/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 186 1.000 Domainoid score I3251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.