DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and ANGPT2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:296 Identity:90/296 - (30%)
Similarity:135/296 - (45%) Gaps:33/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENI-----QKSSSDL----------NTT 71
            |....|..:....|.:|:.|.....:::||.:....|..:     ||...||          .:|
Human   200 DKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMST 264

  Fly    72 GLSGRYPS----------QC-PTYPPAH---GIYTVQV-LGLKPFQVSCDAEIAGTGWTVMARRT 121
            ..|.:.|:          .| ..:...|   ||||:.. ...:..:..||.|..|.|||::.||.
Human   265 SNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRRE 329

  Fly   122 SNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIES 186
            ...::|.|:|.|||.|||...|::::|.:.:..:|..|.:.|.|||:|:||...|:.|:..::.|
Human   330 DGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSS 394

  Fly   187 ENKFYAMTKLGEFTGDAGD-SMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGI 250
            |...|.:...| .||.||. |.|.....:|||.|.|||.....|::...|.||...|..|||.|:
Human   395 EELNYRIHLKG-LTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGM 458

  Fly   251 YVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            |....:... ::.||.|:.|:...||.|...||:||
Human   459 YYPQRQNTN-KFNGIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 76/227 (33%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 17/94 (18%)
FBG 280..494 CDD:214548 75/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.