DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9500 and Fn1

DIOPT Version :9

Sequence 1:	NP_609018.3	Gene:	CG9500 / 33888	FlyBaseID:	FBgn0031804	Length:	292	Species:	Drosophila melanogaster
Sequence 2:	NP_062016.2	Gene:	Fn1 / 25661	RGDID:	2624	Length:	2477	Species:	Rattus norvegicus

Alignment Length:	150	Identity:	34/150 - (22%)
Similarity:	54/150 - (36%)	Gaps:	56/150 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly   177 AHYDEIFIESENKFYAMTKLGEFTGDAGDSM----IHNRNQNFSTFD----RD-----------N 222
            |.::||...:|...|.:....:...|.|..|    :.|....::...    ||           |
  Rat   464 AAHEEICTTNEGVMYRIGDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVN 528

  Fly   223 DGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKG---------DEGQ------YFQWKGIVWHSWRT 272
            |.:||...|.::     ||||   .||   :|         |:.|      ::|    :..||
  Rat   529 DTFHKRHEEGHM-----LNCT---CFG---QGRGRWKCDPIDQCQDSETRTFYQ----IGDSW-- 576

  Fly   273 ESYSYKVMQMMVRPKCHCSG 292
            |.:.:.     ||.:|:|.|
  Rat   577 EKFVHG-----VRYQCYCYG 591

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9500	NP_609018.3	FReD	76..287	CDD:238040	31/143 (22%)
Fn1	NP_062016.2	Fibrin-and heparin-binding 1	53..273
		FN1	53..90	CDD:238018
		fn1	98..136	CDD:278468
		FN1	142..185	CDD:214494
		FN1	187..231	CDD:214494
		fn1	232..271	CDD:278468
		Collagen-binding	308..608		33/149 (22%)
		FN1	308..347	CDD:214494
		FN2	353..401	CDD:128373
		FN2	413..461	CDD:128373
		fn1	470..508	CDD:278468	6/37 (16%)
		FN1	518..560	CDD:214494	12/52 (23%)
		fn1	561..599	CDD:278468	9/41 (22%)
		fn3	611..688	CDD:278470
		fn3	726..796	CDD:278470
		fn3	811..882	CDD:278470
		fn3	907..987	CDD:278470
		fn3	997..1075	CDD:278470
		fn3	1095..1153	CDD:278470
		fn3	1174..1257	CDD:278470
		fn3	1267..1349	CDD:278470
		Cell-attachment	1357..1630
		fn3	1358..1439	CDD:278470
		fn3	1449..1529	CDD:278470
		fn3	1539..1620	CDD:278470
		Cell attachment site	1614..1616
		fn3	1633..1713	CDD:278470
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1661..1685
		FN3	1723..1810	CDD:238020
		Heparin-binding 2	1811..2081
		fn3	1813..1893	CDD:278470
		fn3	1905..1984	CDD:278470
		FN3	1994..2074	CDD:238020
		V region (type III connecting segment, IIICS)	2082..2201
		Cell attachment site	2181..2183
		fn3	2210..2268	CDD:278470
		Fibrin-binding 2	2296..2427
		FN1	2296..2340	CDD:214494
		FN1	2341..2382	CDD:214494
		FN1	2384..2423	CDD:238018
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		mtm12326
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000