DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Tnr

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_037177.2 Gene:Tnr / 25567 RGDID:3886 Length:1358 Species:Rattus norvegicus


Alignment Length:298 Identity:102/298 - (34%)
Similarity:155/298 - (52%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSFYSTEA------MDSESFQNDTAIRNKPELKSL-----YKLVLALLEENQSNASTENIQKSSS 66
            |::.||:.      :|:|    ||.||    |:.|     |.::|...:|...::.|       |
  Rat  1073 LTYKSTDGSRKELIVDAE----DTWIR----LEGLSENTDYTVLLQAAQEATRSSLT-------S 1122

  Fly    67 DLNTTGLSGR---YPSQCPTY----PPAHGIYTVQVLG--LKPFQVSCDAEIAGTGWTVMARRTS 122
            .:.|||  ||   :|..|..:    ....|:||:.:.|  ....||.||....|.||.|..||.:
  Rat  1123 TIFTTG--GRVFSHPQDCAQHLMNGDTLSGVYTIFLNGELSHKLQVYCDMTTDGGGWIVFQRRQN 1185

  Fly   123 NKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTR-YAHYDEIFIES 186
            .:.:|||.||:|:.|||.|:.:|::|||.:|.||....:||.:.:.|  ||.. :|:||:..:|.
  Rat  1186 GQTDFFRKWADYRVGFGNLEDEFWLGLDNIHRITAQGRYELRVDMRD--GQEAVFAYYDKFAVED 1248

  Fly   187 ENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIY 251
            ....|.: ::|.:.|.||||:.:::.:.|||.|||||....|||..|.||||:.||..:||.|.|
  Rat  1249 SRSLYKL-RIGGYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKY 1312

  Fly   252 VKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRPKCH 289
                 |:....:||.|:.|:...:|...::|.:||..|
  Rat  1313 -----GESRHSQGINWYHWKGHEFSIPFVEMKMRPYIH 1345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 80/220 (36%)
TnrNP_037177.2 exchanger_TraA <190..>328 CDD:411343
EGF_Tenascin 203..231 CDD:376143
fn3 328..398 CDD:394996
fn3 416..496 CDD:394996
fn3 507..586 CDD:394996
FN3 595..679 CDD:238020
fn3 687..766 CDD:394996
fn3 776..855 CDD:394996
fn3 865..944 CDD:394996
fn3 954..1026 CDD:394996
FN3 1042..1127 CDD:238020 16/68 (24%)
FReD 1134..1342 CDD:238040 78/215 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.