DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and ANGPTL5

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_835228.2 Gene:ANGPTL5 / 253935 HGNCID:19705 Length:388 Species:Homo sapiens


Alignment Length:345 Identity:96/345 - (27%)
Similarity:146/345 - (42%) Gaps:97/345 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ESFQNDTAIRNKPE----------------------------LKSLYKLVLALLEENQSN----- 55
            ||..|||..:...|                            .:|..||:..:::|.|::     
Human    49 ESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLS 113

  Fly    56 ------------ASTENIQK----------SSSDLNTTGLSGRYPSQCPTYPPAHGIYTVQVLGL 98
                        .:||..:|          .|..|:.|.:.....|...|  |: |:|.:...|.
Human   114 NQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKT--PS-GLYIIHPEGS 175

  Fly    99 K-PFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAIT--KSQP 160
            . ||:|.||.:..|.|.||:.:|....::|.|.|.:|.:|||.|.|:|::||.|:..|.  |:..
Human   176 SYPFEVMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTS 240

  Fly   161 HELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDS---MIHNRNQN---FSTFD 219
            ..||:.||..:....||.||..::|.|.:|:.| .||.::|:|||:   :....|||   |||.|
Human   241 FMLYVALESEDDTLAYASYDNFWLEDETRFFKM-HLGRYSGNAGDAFRGLKKEDNQNAMPFSTSD 304

  Fly   220 RDNDGWH----------KNCAEEY-VGAWWHLNCTYSNLFGIYVKGDEGQYFQWK----GIVWHS 269
            .||||..          |:|:..: ...||...|..:||.||:       :|..|    ||.|.:
Human   305 VDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIH-------HFSGKLLATGIQWGT 362

  Fly   270 W-------RTESYSYKVMQM 282
            |       :.:|.|.|:.:|
Human   363 WTKNNSPVKIKSVSMKIRRM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 79/238 (33%)
ANGPTL5NP_835228.2 FReD 146..382 CDD:238040 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.