DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fgl1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:294 Identity:94/294 - (31%)
Similarity:138/294 - (46%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DSESFQNDTAIRN-----KPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQC 81
            |....|....:|.     :..:|....::..||.|.:........:.|..||   |....|....
  Rat    25 DENCLQEQVRLRAQVRQLETRVKQQQVVIAQLLHEKEVQFLDRGQEDSFIDL---GGKRHYADCS 86

  Fly    82 PTYPPA---HGIYTVQVL-GLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFG--- 139
            ..|...   .|.|.::.| .|..|.|.||....| ||||:.||:....||.|.|.:|:||||   
  Rat    87 EIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDGG-GWTVIQRRSDGSENFNRGWNDYENGFGNFV 150

  Fly   140 QLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAG 204
            |.:|::::|...::.:|....:.|.|.|.|||..:|:|.|::..:..|..||.: .:||::|.||
  Rat   151 QSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYEL-NIGEYSGTAG 214

  Fly   205 DSM---IH--------NRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKG---- 254
            ||:   .|        ::...|||.|||||.::.|||||....||...|..:||.|:|.:|    
  Rat   215 DSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYYQGPYRA 279

  Fly   255 --DEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
              |       .|:||::||...||.|.:.|.:||
  Rat   280 ETD-------NGVVWYTWRGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 83/235 (35%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12326
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.