DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and Fgl1

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_663569.2 Gene:Fgl1 / 234199 MGIID:102795 Length:314 Species:Mus musculus


Alignment Length:291 Identity:91/291 - (31%)
Similarity:140/291 - (48%) Gaps:30/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AMDSES-FQNDTAIRN-----KPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYP 78
            |::||: .:....:|.     :..:|....::..||.|.:.....:..:.|..||   |...:|.
Mouse    22 ALESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDL---GGKKQYA 83

  Fly    79 SQCPTYPPA---HGIYTVQVL-GLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFG 139
            .....|...   .|.|.::.| .|..|.|.||....| ||||:.||:....||.|.|.:|:||||
Mouse    84 DCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGG-GWTVIQRRSDGSENFNRGWNDYENGFG 147

  Fly   140 ---QLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTG 201
               |.:|::::|...::.:|....:.|.|.|.|||..:.:|.|....:..:..||.: .:||::|
Mouse   148 NFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYEL-NIGEYSG 211

  Fly   202 DAGDSM---IH--------NRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGD 255
            .||||:   .|        ::...|||:|||||.:..|||||....||...|..:||.|:|.:|.
Mouse   212 TAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGS 276

  Fly   256 EGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286
            ...... .|:||::|....||.|.:.|.:||
Mouse   277 YRAETD-NGVVWYTWHGWWYSLKSVVMKIRP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 79/229 (34%)
Fgl1NP_663569.2 FReD 80..306 CDD:238040 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.