DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and FGG

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:363 Identity:99/363 - (27%)
Similarity:150/363 - (41%) Gaps:92/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSFYSTEA-MDSESFQNDT-AIRNK-PELKSLYKLVLALLEENQS------NAST-------ENI 61
            ||.|.|:. .|.:|.::.. .:.|| .|:|.|.|.:......::|      :|:|       |.|
Human    55 LSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEI 119

  Fly    62 QKSSSDLNTTGLSGRYPSQ--------------------------CPTYPPAH------------ 88
            .|..:.:.|...|.||..:                          |......|            
Human   120 MKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIAN 184

  Fly    89 ------GIYTVQVL-GLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLD---- 142
                  |:|.::.| ..:.|.|.|:.:.:|.||||..:|....::|.::|.:||.|||.|.    
Human   185 KGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGT 249

  Fly   143 GDFFIGLDKLHAITKSQ--PHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGD 205
            .:|::|.:|:|.|:...  |:.|.:.|||:.|:|..|.|....:..|...|.:|......|||||
Human   250 TEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGD 314

  Fly   206 SM---------------IHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGD 255
            :.               .||..| |||:|.|||.:..||||:....||...|...:|.|:|.:| 
Human   315 AFDGFDFGDDPSDKFFTSHNGMQ-FSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQG- 377

  Fly   256 EGQYFQW-------KGIVWHSWRTESYSYKVMQMMVRP 286
             |.|.:.       .||:|.:|:|..||.|...|.:.|
Human   378 -GTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 79/284 (28%)
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864 23/116 (20%)
FReD 175..414 CDD:294064 74/241 (31%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 6/15 (40%)
Platelet aggregation and Staphylococcus clumping 423..437
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.