DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9500 and FCN2

DIOPT Version :9

Sequence 1:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:221 Identity:89/221 - (40%)
Similarity:120/221 - (54%) Gaps:15/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PSQCPTYPPA-----------HGIYTVQVLGLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSW 131
            |..|.|.|..           .|.:|:.:...:|..|.||.:..|.||||..||....::|:|.|
Human    95 PQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDW 159

  Fly   132 AEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKL 196
            |.||.|||...|:|::|.|.:||:|.....||.:.|.|||...::|.|....:..|.:.|.:. |
Human   160 ATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLV-L 223

  Fly   197 GEFT-GDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYF 260
            |.|. |.||||:..:.||:|||.|:|||....|||..:.||||:.||..|||.|.|::|..|.:.
Human   224 GAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFA 288

  Fly   261 QWKGIVWHSWRTESYSYKVMQMMVRP 286
              .||.|.|.:..:|||||.:|.|||
Human   289 --NGINWKSGKGYNYSYKVSEMKVRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9500NP_609018.3 FReD 76..287 CDD:238040 89/221 (40%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99 1/3 (33%)
FReD 102..312 CDD:238040 84/212 (40%)